PUF60 Rabbit Polyclonal Antibody

• Catalog Number: orb577766
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PUF60
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PUF60
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: PUF60
• UniProt ID: Q9UHX1
• Protein Sequence: Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
• NCBI: NP_055096
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FIR, VRJS, RoBPI, SIAHBP1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-PUF60 Antibody Paraffin Embedded Tissue: Human Intestine Cellular Data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-PUF60 Antibody, Titration: 0.5 ug/ml, Positive Control: Human 293T cell lysate.

WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela. PUF60 is supported by BioGPS gene expression data to be expressed in HeLa.