PTTG1IP purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295262
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human PTTG1IP protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length human protein.
• Protein Sequence: MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH20983

Immunofluorescence of purified MaxPab antibody to PTTG1IP on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP MaxPab polyclonal antibody. Lane 1: PTTG1IP transfected lysate(19.91 KDa). Lane 2: Non-transfected lysate.