You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295261 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant PTTG1IP. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN |
Tested applications | ELISA, IF, WB |
Clone Number | 4C11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH20983 |
Detection limit for recombinant GST tagged PTTG1IP is 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PTTG1IP on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody (M04), clone 4C11. Lane 1: PTTG1IP transfected lysate(20.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (45.54 KDa).