Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PTGER3 Rabbit Polyclonal Antibody

SKU: orb574934

Description

PTGER3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PTGER3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PTGER3. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityHuman

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PTGER3
TargetPTGER3
Protein SequenceSynthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Molecular Weight57 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875

Similar Products

  • EP3 rabbit pAb Antibody [orb769764]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PTGER3 Antibody (N-term) [orb1928092]

    FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EP3 rabbit pAb Antibody [orb765142]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PTGER3 Rabbit Polyclonal Antibody [orb630339]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PTGER3 Rabbit Polyclonal Antibody [orb574935]

    WB

    Equine, Rabbit

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PTGER3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

PTGER3 Rabbit Polyclonal Antibody

Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

PTGER3 Rabbit Polyclonal Antibody

WB Suggested Anti-PTGER3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_942011

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PTGER3 Rabbit Polyclonal Antibody (orb574934)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry