PSORS1C1 Rabbit Polyclonal Antibody

SKU: orb581673

Description

Rabbit polyclonal antibody to PSORS1C1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: PSORS1C1
• Protein Sequence: Synthetic peptide located within the following region: MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHME
• Molecular Weight: 16kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SEEK1, C6orf16

WB Suggested Anti-PSORS1C1 Antibody, Titration: 3 ug/ml, Positive Control: MCF-7.

25 ug of the indicated whole cell extracts was loaded onto a 10-20% gradient SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended antibody dilution is 1 ug/ml to 3 ug/ml.

WB Suggested Anti-PSORS1C1 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.

Quick Database Links

Gene Symbol

PSORS1C1

UniProt

Q9UIG5

RefSeq (Protein):NP_054787