PSMA1 Rabbit Polyclonal Antibody

• Catalog Number: orb577574
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMA1
• Target: PSMA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA1
• Protein Sequence: Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
• UniProt ID: P25786
• MW: 29kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NU, HC2, PROS30, HEL-S-275
• Research Area: Molecular Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_002777
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-PSMA1 Antibody, Catalog Number: orb577574, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human non-small cell lung cancer (NCI-460), Primary Dilution: 1:2000, Secondary Dilution: 1:3000, 50kDa band is a tubulin loading control band. PSMA1 is strongly supported by BioGPS gene expression data to be expressed in Human NCI460 cells.

WB Suggested Anti-PSMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.