PSG9 Rabbit Polyclonal Antibody

• Catalog Number: orb578326
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSG9
• Target: PSG9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSG9
• Protein Sequence: Synthetic peptide located within the following region: YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI
• UniProt ID: Q00887
• MW: 54kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PS34, PSG11, PSGII, PSBG-9, PSBG-11
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: EAW57184

WB Suggested Anti-PSG9 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.