You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
PSG3 Rabbit Polyclonal Antibody
Catalog Number: orb578527
Product Properties
| Catalog Number | orb578527 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PSG3 |
| Target | PSG3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PSG3 |
| Protein Sequence | Synthetic peptide located within the following region: VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS |
| UniProt ID | Q16557 |
| MW | 16kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | AAD28498 |
Images
Human kidney
WB Suggested Anti-PSG3 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.
Similar Products
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
PSG3 Rabbit Polyclonal Antibody [orb312495]
WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl 
Reviews
PSG3 Rabbit Polyclonal Antibody (orb578527)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review