PRSS58 Rabbit Polyclonal Antibody

• Catalog Number: orb326420
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRSS58
• Target: PRSS58
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LPYQTISENTMCSVSTWSYNVCDIYKEPDSLQTVNISVISKPQCRDAYKT
• UniProt ID: Q8IYP2
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ16649 antibody, anti MGC35022 antibody, an
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001001317

WB Suggested Anti-PRSS58 Antibody, Titration: 1.0 ug/mL, Positive Control: U937 Whole Cell.