PRPSAP2 Rabbit Polyclonal Antibody

• Catalog Number: orb583163
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRPSAP2
• Target: PRPSAP2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRPSAP2
• Protein Sequence: Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ
• UniProt ID: O60256
• MW: 41kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAP41
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_002758

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Hela Whole cell lysates, Antibody dilution: 2.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:100, Positive Control: HepG2 cell lysate.