PRPS2 Rabbit Polyclonal Antibody

• Catalog Number: orb330182
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRPS2
• Target: PRPS2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPS2
• Protein Sequence: Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
• UniProt ID: P11908
• MW: 35kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti PRS II antibody, anti PRSII antibody
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_002756
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-PRPS2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PRPS2 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.