PRPH monoclonal antibody (M02), clone 3B3

• Catalog Number: orb2292333
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PRPH.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PRPH (NP_006253, 374 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 3B3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006253

Detection limit for recombinant GST tagged PRPH is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PRPH on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PRPH on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

PRPH monoclonal antibody (M02), clone 3B3. Western Blot analysis of PRPH expression in IMR-32.

Western Blot detection against Immunogen (36.41 KDa).