PRPF6 Rabbit Polyclonal Antibody

• Catalog Number: orb577752
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRPF6
• Target: PRPF6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRPF6
• Protein Sequence: Synthetic peptide located within the following region: FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
• UniProt ID: O94906
• MW: 104kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20o
• Note: For research use only
• NCBI: NP_036601

WB Suggested Anti-PRPF6 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.