Cart summary

You have no items in your shopping cart.

PRPF18 Peptide - middle region

PRPF18 Peptide - middle region

Catalog Number: orb2004659

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2004659
CategoryProteins
DescriptionPRPF18 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL
UniProt IDQ99633
MW37kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with PRPF18 Rabbit Polyclonal Antibody (orb585462). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesPRP18, hPrp18
NoteFor research use only
NCBINP_003666