PRPF18 Rabbit Polyclonal Antibody

• Catalog Number: orb585462
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRPF18
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PRPF18
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: PRPF18
• UniProt ID: Q99633
• Protein Sequence: Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL
• NCBI: NP_003666
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PRP18, hPrp18
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Placenta lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Ovary Tumor (T-OV), Negative control (-): HeLa cell lysate (HL), Antibody concentration: 1 ug/ml.