You have no items in your shopping cart.
Cart summary
Protein archease, Pyrococcus horikoshii, Recombinant (His & Myc)
Catalog Number: orb1976725
| Catalog Number | orb1976725 |
|---|---|
| Category | Proteins |
| Description | Activates the tRNA-splicing ligase complex by facilitating the enzymatic turnover of catalytic subunit RtcB. Acts by promoting the guanylylation of RtcB, a key intermediate step in tRNA ligation. Can also alter the NTP specificity of RtcB such that ATP, dGTP or ITP is used efficiently. Protein archease, Pyrococcus horikoshii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.1 kDa and the accession number is O59205. |
| Tag | N-10xHis, C-Myc |
| Protein Sequence | MKKWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVMVNVNKVEKKEVREIEVEAEDLEALLYSFLEELLVIHDIEGLVFRDFEVKIERVNGKYRLRAKAYGEKLDLKKHEPKEEVKAITYHDMKIERLPNGKWMAQLVPDI |
| UniProt ID | O59205 |
| MW | 24.1 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Pyrococcus horikoshii |
| Expression Region | 1-142 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
