You have no items in your shopping cart.
Cart summary
Protease 7 Protein, E. coli O157:H7, Recombinant (G236K K237G, His & SUMO)
Catalog Number: orb1979233
| Catalog Number | orb1979233 |
|---|---|
| Category | Proteins |
| Description | Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 49.5 kDa (predicted) |
| UniProt ID | P58603 |
| Protein Sequence | STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues. |
| Expression Region | 21-317 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
