ZNF341 Antibody - middle region Discontinued

SKU: orb2276184

Description

ZNF341 Antibody - middle region is an unconjugated, affinity purified antibody. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ZNF341. This antibody reacts with Human samples. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF341
• Protein Sequence: Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
• Molecular Weight: 92kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HIES3

Quick Database Links

UniProt

Q9BYN7

RefSeq (Protein):NP_116208

Yaoyi Li 1, Yingliang Sheng 2, Chao Di 3, Hongjie Yao Base-pair resolution reveals clustered R-loops and DNA damage-susceptible R-loops Base-pair resolution reveals clustered R-loops and DNA damage-susceptible R-loops, Mol Cell ., (2025)

PubMed: 40112807

Y Li, Y Sheng, C Di, H Yao Capturing R-loops at base-pair resolution unveils clustered R-loops regulate gene expression in a number-dependent manner bioRxiv, (2025)

PubMed: