ZNF311 Peptide - C-terminal region

SKU: orb2008241

Description

ZNF311 Peptide - C-terminal region, also known as zf31, is a synthetic peptide designed for use in combination with ZNF311 Rabbit Polyclonal Antibody (orb325572). It corresponds to the sequence QDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQ and is supplied in a lyophilized powder. This peptide is for research use only.

Images & Validation

• Application Notes:
  This is a synthetic peptide designed for use in combination with ZNF311 Rabbit Polyclonal Antibody (orb325572). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: QDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQ

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

zf31