[Tyr0]-Urocortin (rat)

SKU: orb2694883

Description

(Tyr0)-Urocortin, rat is a high-affinity agonist of corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2). (Tyr0)-Urocortin, rat shows inhibitory binding constants (Ki) of 1-2 nM.

Images & Validation

−

Key Properties

−

Target	CRFR
CAS Number	187111-93-9
MW	4870.55
Purity	≥95%
Formula	C₂₁₅H₃₄₇N₆₃O₆₆
Protein Sequence	YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

CRFR

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	> 95%
MW:	4870.55
Source:	Synthetic

[Tyr0]-Urocortin (rat)

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products

[Tyr0]-Urocortin [orb364116]