You have no items in your shopping cart.
Description
Images & Validation
−![[Tyr0]-BNP-32 (human)](/images/quality_badge_proteins.png)
Key Properties
−| CAS Number | 1815617-97-0 |
|---|---|
| MW | 3627.28 |
| Purity | ≥95% |
| Formula | C152H253N51O44S4 |
| Protein Sequence | YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfide bridge: Cys11-Cys27) |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide