You have no items in your shopping cart.
Description
Research Area
Epigenetics
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRPT1 |
| Target | TRPT1 |
| Protein Sequence | Synthetic peptide located within the following region: GNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQ |
| Molecular Weight | 27kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti TRPT1 antibody, anti antibody
Similar Products
−TRPT1 Rabbit Polyclonal Antibody [orb632188]
ELISA, IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
TRPT1
UniProt
UniProt Details
− No UniProt data available



