TMEM259 Peptide - N-terminal region

SKU: orb2000401

Description

TMEM259 Peptide - N-terminal region, also known as MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN, is a synthetic peptide designed for use in combination with TMEM259 Rabbit Polyclonal Antibody (orb55799). It corresponds to the sequence APGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSR and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  This is a synthetic peptide designed for use in combination with TMEM259 Rabbit Polyclonal Antibody (orb55799). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: Synthetic peptide located within the following region: APGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSR

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN

Quick Database Links

UniProt

Q4ZIN3

RefSeq (Protein):NP_001028198.1