Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TGFBR2 Rabbit Polyclonal Antibody

SKU: orb333717

Description

TGFBR2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TGFBR2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human TGFBR2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Goat, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Goat, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TGFBR2
TargetTGFBR2
Protein SequenceSynthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Molecular Weight65 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-AAT3 antibody, anti-FAA3 antibody, anti-LDS1B antibody, anti-LDS2 antibody, anti-LDS2B antibody, anti-MFS2 antibody, anti-RIIC antibody, anti-TAAD2 antibody, anti-TbetaR II antibody, anti-TbetaR-II antibody, anti-TGF beta receptor type 2 antibody, anti-TGF beta receptor type IIB antibody, anti-TGF beta type II receptor antibody, anti-TGF-beta receptor type II antibody, anti-TGF-beta receptor type-2 antibody, anti-TGF-beta type II receptor antibody, anti-TGF-beta-R2 antibody, anti-TGFB R2 antibody, anti-TGFbeta - RII antibody, anti-TGFbeta RII antibody, anti-Tgfbr2 antibody, anti-TGFR-2 antibody, anti-TGFR2_HUMAN antibody, anti-HNPCC6 antibody, anti-TGF-beta receptor type IIB antibody, anti-TGFbeta-RII antibody, anti-transforming growth factor beta receptor type IIC antibody, anti-Transforming growth factor-beta receptor type II antibody

Similar Products

  • TGF beta Receptor 2 Rabbit Polyclonal Antibody [orb11471]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    500 μg, 100 μg
  • TGFBR2 Antibody (N-term) [orb1937905]

    IF,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • TGF beta Receptor II Rabbit Polyclonal Antibody [orb500790]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TGF beta Receptor 2 Rabbit Polyclonal Antibody [orb371959]

    ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TGF beta Receptor 2 Rabbit Polyclonal Antibody [orb315555]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003233

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry