Tbc1d23 Peptide - C-terminal region

SKU: orb2005421

Description

Tbc1d23 Peptide - C-terminal region, also known as 4930451A13Rik, AU015720, AU043671, AU043778, D030022P07Rik, W51689, is a synthetic peptide designed for use in combination with Tbc1d23 Rabbit Polyclonal Antibody (orb326689). It corresponds to the sequence SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Application Notes:
  This is a synthetic peptide designed for use in combination with Tbc1d23 Rabbit Polyclonal Antibody (orb326689). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: Synthetic peptide located within the following region: SKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATRAIKQQIMKVLD

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

4930451A13Rik, AU015720, AU043671, AU043778, D030022P07Rik, W51689

Quick Database Links

UniProt

Q8K0F1

RefSeq (Protein):NP_080530