Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

STK3 Rabbit Polyclonal Antibody

SKU: orb580491

Description

STK3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of STK3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human STK3. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

−
Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STK3
TargetSTK3
Protein SequenceSynthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
KRS1, MST2

Similar Products

−
  • Phospho-MST4 + MST3 + STK25 (Thr178 + Thr190 + Thr174) Rabbit Polyclonal Antibody [orb185140]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Mst2 Rabbit Polyclonal Antibody [orb157906]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • STK3 Rabbit Polyclonal Antibody [orb580492]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Krs-1/2 (phospho Thr183) rabbit pAb Antibody [orb770181]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • MST-3 rabbit pAb Antibody [orb765736]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006272

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry