SPARC Antibody

SKU: orb1177266

Description

Rabbit polyclonal antibody to SPARC. Sub-cellular localization: Secreted, extracellular space, extracellular matrix, basement membrane.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

• Tested Applications: WB
• Dilution Range: Western blot: 0.1-0.5μg/ml
• Reactivity: Human
• Application Notes:
  Size: 100 µg/vial | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.

  Read more...

Key Properties

• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids.
• Target: SPARC
• Molecular Weight: Observed bind size: 35KD
• Purity: Immunogen affinity purified.
• Purification: Immunogen affinity purified.
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
• Concentration: Reconstitute with 0.2 mL sterile dH2O.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AA517111 antibody, Basement membrane protein 40 antibody, Basement-membrane protein 40 antibody, BM 40 antibody, BM-40 antibody, BM40 antibody, Cysteine rich protein antibody, hm:zeh0062 antibody, MGC128090 antibody, ON antibody, Osteonectin antibody, Secreted acidic cystein rich glycoprotein antibody, Secreted protein acidic and rich in cysteine antibody, Secreted protein acidic cysteine rich (osteonectin) antibody, Secreted protein acidic cysteine rich antibody, SPARC antibody, SPRC antibody, SPRC_HUMAN antibody

Quick Database Links

Gene Symbol

SPARC

UniProt

P09486