SLC2A12 Rabbit Polyclonal Antibody

SKU: orb579053

Description

SLC2A12 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC2A12. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SLC2A12. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC2A12
• Target: SLC2A12
• Protein Sequence: Synthetic peptide located within the following region: FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATL
• Molecular Weight: 67kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GLUT8, GLUT12

Quick Database Links

Gene Symbol

SLC2A12

UniProt

Q8TD20

RefSeq (Protein):NP_660159