SLC20A2 Rabbit Polyclonal Antibody

SKU: orb327510

Description

SLC20A2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC20A2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SLC20A2. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics, Infectious Diseases

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC20A2
• Target: SLC20A2
• Protein Sequence: Synthetic peptide located within the following region: NAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDAPEVHLLF
• Molecular Weight: 70 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti PIT2 antibody, anti RAM1 antibody, anti GLVR2 antibody, anti IBGC1 antibody, anti IBGC3 antibody, anti MLVAR antibody, anti PIT-2 antibody, anti GLVR-2 antibody

Quick Database Links

Gene Symbol

SLC20A2

UniProt

Q08357

RefSeq (Protein):NP_001244109.1