SERPIND1 Rabbit Polyclonal Antibody

SKU: orb578022

Description

SERPIND1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SERPIND1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SERPIND1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPIND1
• Target: SERPIND1
• Protein Sequence: Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ
• Molecular Weight: 55kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HC2, LS2, HCF2, HCII, HLS2, THPH10, D22S673

Quick Database Links

Gene Symbol

SERPIND1

UniProt

P05546

RefSeq (Protein):NP_000176