You have no items in your shopping cart.
Mouse C-type lectin domain family 4 member E (Clec4e) Recombinant Protein
SKU: orb1649779
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| Immunogen | Expression Region:46-214aa; Sequence Info:Extracellular Domain |
| Tag | N-terminal 6xHis-tagged |
| MW | 23.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−C-type lectin superfamily member 9 Macrophage-inducible C-type lectin
Similar Products
−Mouse CLEC4E Recombinant Protein (N-His) [orb2963614]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
19.65 kDa
50 μg, 100 μg, 1 mgRecombinant Mouse CLEC4E Protein, N-His [orb2831406]
>90% as determined by SDS-PAGE.
19.65 kDa
20 μg, 50 μg, 100 μgMouse CLEC4E Recombinant Protein, N-His [orb3056621]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
19.65 kDa
1 mg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days