Recombinant Human Sex-determining region Y protein (SRY)

SKU: orb3011212

Description

This Recombinant Human Sex-determining region Y protein (SRY) spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Key Properties

• Expression System: Baculovirus
• Biological Origin: Homo sapiens (Human)
• Expression Region: 1-204
• Protein Length: 204
• Endotoxins: Not test
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL

Storage & Handling

• Storage: Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Sex-determining region Y protein; Testis-determining factor; SRY TDF

Quick Database Links

UniProt

Q05066