You have no items in your shopping cart.
Human Ras-related R-Ras2 (RRAS2) Recombinant Protein
SKU: orb1647508
Description
Research Area
Signal Transduction
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| Immunogen | Expression Region:1-204aa; Sequence Info:Full Length |
| Tag | N-terminal GST-tagged |
| MW | 49.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHC |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Ras-like protein TC21 Teratocarcinoma oncogene
Similar Products
−- Item 1 of 3
- Item 1 of 1
RRAS2 Mouse Monoclonal Antibody [orb1473835]
WB
Human, Mouse
Mouse
Monoclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl Human RRAS2 Recombinant Protein (N-His) [orb3153752]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
25.20 kDa
1 mg, 50 μg, 100 μgHuman RRAS2 Protein [orb428223]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days