You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| Immunogen | Expression Region:22-114aa; Sequence Info:Full Length |
| Tag | N-terminal 6xHis-tagged |
| MW | 14.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ATACC motif chemokine 1Cytokine SCM-1Lymphotaxin; SCM-1-alpha; Small-inducible cytokine C1XC chemokine ligand 1
Similar Products
−Recombinant Human XCL1 Protein [orb2994715]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 38.2 KDa. Observed: 54 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman Lymphotactin/XCL1 Recombinant Protein [orb1906074]
> 98 % by SDS-PAGE and HPLC analyses.
Approximately 10.2 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.
5 μg, 100 μg, 500 μg- Item 1 of 1
- Item 1 of 1
Human XCL1/Lymphotactin ELISA Kit (DIY Antibody Pairs) [orb1098222]
Human
62.5 pg/ml - 4,000 pg/ml
5 plate Human XCL1/Lymphotactin Recombinant Protein (N-GST) [orb2968489]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
11.45 kDa
50 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days