You have no items in your shopping cart.
Human Ethanolaminephosphotransferase 1, EPT1 Recombinant Protein, N-GST
SKU: orb1631260
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| MW | 32.3kDa |
| Purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Protein Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP |
Storage & Handling
−| Storage | Store at < -2°C, stable for 6 months after receipt.; Please minimize freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days