Human EPO-alpha, Fc Chimera (EPOFc) (Active) Recombinant Protein

SKU: orb1650725

Description

Human EPO-alpha, Fc Chimera (EPOFc) (Active) Recombinant Protein

Key Properties

• Species/Host: Mammal
• Immunogen: Expression Region:28-193aa; Sequence Info:Full Length of Mature Protein
• Tag: C-terminal FC-tagged
• MW: 45.3 kDa
• Purity: >98% as determined by SDS-PAGE and HPLC.
• Protein Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR+IEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Buffer/Preservatives: 0.2μm filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid) ,lyophilized
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Epoetin,

Quick Database Links

UniProt

P01588