You have no items in your shopping cart.
Human Cytochrome b-c1 Complex Subunit 6, UQCRH Recombinant Protein, N-GST
SKU: orb1648473
Description
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| MW | 37.5kDa |
| Purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Protein Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK |
Storage & Handling
−| Storage | Lyophilized protein should be stored at < -2°C, though stable at room temperature for 3 weeks.; Reconstituted protein solution can be stored at 4-7C for 2-7 days.; Aliquots of reconstituted samples are stable at < -2°C for 3 months. |
|---|---|
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide