You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Species/Host | Yeast |
|---|---|
| Immunogen | Expression Region:1-313aa; Sequence Info:Full Length |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| MW | 39.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Aminoacylase-2 ACY2, ASP
Similar Products
−- Item 1 of 1
Human ASPA Recombinant Protein (N-His) [orb3149550]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
37.90 kDa
1 mg, 50 μg, 100 μg Human ASPA Protein, His Tag/His-IF2DI Tag [orb754591]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
34.3 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mgHuman ASPA Protein [orb753008]
Greater than 90.0% as determined by SDS-PAGE.
E.coli
1 μg, 5 μg, 50 μgHuman ASPA Protein [orb167936]
Greater than 90% as determined by SDS-PAGE.
Escherichia Coli
5 μg, 20 μg, 1 mgHuman Aspartoacylase (ASPA) Recombinant Protein [orb1646422]
Greater than 85% as determined by SDS-PAGE.
39.7 kDa
100 μg, 20 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days