Escherichia coli O6:H1 Cell division FtsZ (ftsZ) Recombinant Protein

SKU: orb1631500

Description

Escherichia coli O6:H1 Cell division FtsZ (ftsZ) Recombinant Protein is expressed in an E. coli system and features the N-terminal 6xHis-SUMO tag. It achieves a purity of greater than 90% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology

Key Properties

• Species/Host: E. coli
• Immunogen: Expression Region:1-383aa; Sequence Info:Full Length
• Tag: N-terminal 6xHis-SUMO-tagged
• MW: 56.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Buffer/Preservatives: Tris-based buffer50% glycerol
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P0A9A7