You have no items in your shopping cart.
Recombinant Dictyostelium discoideum Probable mitochondrial 2-oxoglutarate/malate carrier protein(ucpC)
SKU: orb2910134
Description
Images & Validation
−
Key Properties
−| Biological Origin | Dictyostelium discoideum (Slime mold) |
|---|---|
| Expression Region | 1-318 |
| Protein Length | full length protein |
| Protein Sequence | MSSFNTQNKNVLQTPIPAPTPQSQLKQFVIGGLAGMLSSAFTHPIDSLKVRMQLQGEGTG VGPKRGALKMLVHINQTEGFFTLYKGLSASLLRQATYTTTRFGLYDLIKDIVAKDDKPLP FTQKIMVGMLSGAGGAIVGTPADLTMVRMQADGKLPFNLRRNYKNVFDGIFRISKEEGII SLWKGCSPNLIRAMFMTAGQVSSYDQTKQLMLASGYFHDDIKTHLIASTTAAFVAAVATS PLDVIKTRIMNSPKTVTGELQYKGTFDCLSKTLRAEGFKAFYKGFNPYFMRLGPQTILTF IFVEQLNILWKKSQSYFK |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Probable mitochondrial 2-oxoglutarate/malate carrier protein, OGCP, Mitochondrial substrate carrier family protein ucpC, Solute carrier family 25 member 11 homolog

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide