Aspergillus niger Probable alpha-galactosidase B (aglB) Recombinant Protein

SKU: orb1650977

Description

Aspergillus niger Probable alpha-galactosidase B (aglB) Recombinant Protein is expressed in a yeast system and features the N-terminal 6xHis tag. It achieves a purity of greater than 90% as determined by SDS-PAGE.

Key Properties

• Species/Host: Yeast
• Immunogen: Expression Region:21-443aa; Sequence Info:Full Length
• Tag: N-terminal 6xHis-tagged
• MW: 48.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Buffer/Preservatives: Tris-based buffer50% glycerol
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Melibiase B

Quick Database Links

UniProt

A2QEJ9