PSG1 Rabbit Polyclonal Antibody

SKU: orb330233

Description

PSG1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of PSG1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1
• Target: PSG1
• Protein Sequence: Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
• Molecular Weight: 47kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti B1G1 antibody, anti CD66f antibody, anti DHFRP2 antibody, anti FLJ90598 antibody, anti FLJ90654 antibody, anti PBG1 antibody, anti PSBG1 antibody, anti PSG IIA-d antibody, anti PSGGA antibody, anti PSGIIA-a antibody, anti PSGIIA-b antibody, anti PSGIIA-c antibody, anti SP1 antibody, anti PSGIIA antibody

Quick Database Links

Gene Symbol

PSG1

UniProt

Q6ICR4

RefSeq (Protein):NP_008836