Prolactin Releasing Peptide (1-31), HumanPrRP-31

SKU: orb2693760

Description

Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis.

Key Properties

• Target: GnRH Receptor
• CAS Number: 215510-22-8
• MW: 3664.2
• Purity: ≥95%
• Formula: C₁₆₀H₂₅₂N₅₆O₄₂S
• Protein Sequence: SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2

Storage & Handling

• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

Gene Symbol

GnRH Receptor