Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PRDX1 Rabbit Polyclonal Antibody

SKU: orb330556

Description

PRDX1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PRDX1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human PRDX1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

−
Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRDX1
TargetPRDX1
Protein SequenceSynthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
Molecular Weight22kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
anti MSP23 antibody, anti NKEFA antibody, anti PAG antibody, anti PAGA antibody, anti PAGB antibody, anti PRX1 antibody, anti TDPX2 antibody, anti PRXI antibody

Similar Products

−
  • Peroxiredoxin 1/PRDX1 Rabbit Polyclonal Antibody [orb251531]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PRDX1 Antibody (Center) [orb1931334]

    FC,  IHC-P,  WB

    Hamster, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Peroxiredoxin 1 Rabbit Polyclonal Antibody [orb6796]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PRX I rabbit pAb Antibody [orb767060]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PRDX1 Rabbit pAb Antibody [orb763658]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002565

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry