You have no items in your shopping cart.
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Purity | Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
|---|---|
| Protein Sequence | KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 |
Storage & Handling
−| Storage | Stability: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The protein was lyophilized with no additives. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Pramlintide Acetate Hydrate [orb525634]
>97%
196078-30-5
3949.39
C171H267N51O53S2.X(C2H4
100 mg, 250 mg, 1 g
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days