PERLD1 Rabbit Polyclonal Antibody

SKU: orb325558

Description

PERLD1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PGAP3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human PERLD1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PERLD1
• Target: PGAP3
• Protein Sequence: Synthetic peptide located within the following region: ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV
• Molecular Weight: 36kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AGLA546 antibody, anti CAB2 antibody, anti MGC9753 antibody, anti PP1498 antibody, anti PER1 antibody, anti PERLD1 antibody

Quick Database Links

Gene Symbol

PGAP3

UniProt

Q96FM1

RefSeq (Protein):NP_219487