You have no items in your shopping cart.
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| Target | Thyroid Hormone Receptor |
|---|---|
| CAS Number | 12583-68-5 |
| MW | 4108.7 |
| Purity | ≥95% |
| Formula | C183H288N54O50S2 |
| Protein Sequence | AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Parathyroid Hormone (1-34), bovine [orb2276868]
99.72% (May vary between batches)
4104.39
1 mg, 25 mg, 50 mg, 5 mg, 10 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
Thyroid Hormone Receptor
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide