P2RY2 Peptide - C-terminal region

SKU: orb2009630

Description

P2RY2 Peptide - C-terminal region, also known as HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R, is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585578). It corresponds to the sequence KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE and is supplied in a lyophilized powder. This peptide is for research use only.

Images & Validation

• Tested Applications: WB
• Application Notes:
  This is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585578). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R

Quick Database Links

UniProt

P41231

RefSeq (Protein):NP_788085