Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

NSMCE3 Peptide - middle region

SKU: orb2012016

Description

NSMCE3 Peptide - middle region, also known as HCA4, LICS, NSE3, NDNL2, MAGEG1, MAGEL3, is a synthetic peptide designed for use in combination with NSMCE3 Rabbit Polyclonal Antibody (orb330941). It corresponds to the sequence IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with NSMCE3 Rabbit Polyclonal Antibody (orb330941). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

Protein SequenceIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HCA4, LICS, NSE3, NDNL2, MAGEG1, MAGEL3
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_619649

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide
WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 200.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry