NFKB1/NF-Kappa-B Antibody

SKU: orb1539095

Description

NFKB1/NF-Kappa-B Antibody

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC, IHC-P (5 - 10 µg/ml), WB (0.2 - 1 µg/ml)
• Reactivity: Gallus, Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Synthetic peptide from N-Terminus of human NFKB1 (P19838, NP_003989, aa 11-60) within the region PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig (100%); Rabbit, Turkey, Zebra finch, Chicken (92%); Stickleback, Zebrafish (85%); Salmon (84%).
• Target: NFKB1 / NF-Kappa-B
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 0.09% sodium azide, 2% sucrose
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NFKB1, Ebp- 1, EBP-1, NF-KappaB p50, NFkappaB, NFKB-p50, KBF1, NF-kappa-B, NF-kappaB, NF-kB1, NFKB-p105, p105, p50, DNA binding factor KBF1, DNA-binding factor KBF1, NF-kappabeta

Quick Database Links

Gene Symbol

NFKB1 / NF-Kappa-B