Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NFKB1/NF-Kappa-B Antibody

SKU: orb1539095

Description

NFKB1/NF-Kappa-B Antibody

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, IHC-P, WB
Dilution RangeIHC, IHC-P (5 - 10 µg/ml), WB (0.2 - 1 µg/ml)
ReactivityGallus, Human

Key Properties

HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenSynthetic peptide from N-Terminus of human NFKB1 (P19838, NP_003989, aa 11-60) within the region PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig (100%); Rabbit, Turkey, Zebra finch, Chicken (92%); Stickleback, Zebrafish (85%); Salmon (84%).
TargetNFKB1 / NF-Kappa-B
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, 0.09% sodium azide, 2% sucrose
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NFKB1, Ebp- 1, EBP-1, NF-KappaB p50, NFkappaB, NFKB-p50, KBF1, NF-kappa-B, NF-kappaB, NF-kB1, NFKB-p105, p105, p50, DNA binding factor KBF1, DNA-binding factor KBF1, NF-kappabeta
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

Available Sizes

Select a size below

50 μl
$ 700.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry